PDB entry 1ccr

View 1ccr on RCSB PDB site
Description: structure of rice ferricytochrome c at 2.0 angstroms resolution
Deposited on 1983-03-14, released 1983-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1987-04-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ccr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccr_ (-)
    asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
    knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats