PDB entry 1ccj

View 1ccj on RCSB PDB site
Description: conformer selection by ligand binding observed with protein crystallography
Deposited on 1997-01-22, released 1997-07-23
The last revision prior to the SCOP 1.69 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1ccj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ccj_ (-)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnegylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ccj_ (-)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnegylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl