PDB entry 1cch

View 1cch on RCSB PDB site
Description: the solution conformation of cytochrome c-551 from p.stutzeri zobell determined by nmr+
Class: electron transport
Keywords: electron transport
Deposited on 1994-02-25, released 1994-04-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c551
  Species: Pseudomonas stutzeri [TaxId:316]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00101 (0-81)
  Domains in SCOPe 2.04: d1ccha_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cchA (A:)
  qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
  mppnpvteeeakilaewvlslk