PDB entry 1cch

View 1cch on RCSB PDB site
Description: the solution conformation of cytochrome c-551 from p.stutzeri zobell determined by nmr+
Deposited on 1994-02-25, released 1994-04-30
The last revision prior to the SCOP 1.63 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1cch__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cch_ (-)
  qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
  mppnpvteeeakilaewvlslk