PDB entry 1ccd

View 1ccd on RCSB PDB site
Description: refined structure of rat clara cell 17 kda protein at 3.0 angstroms resolution
Deposited on 1991-09-17, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1ccd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ccd_ (-)
  ssdicpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivk
  ltekiltsplceqdlrv