PDB entry 1ccd

View 1ccd on RCSB PDB site
Description: refined structure of rat clara cell 17 kda protein at 3.0 angstroms resolution
Class: phospholipase a2 inhibitor
Keywords: phospholipase a2 inhibitor
Deposited on 1991-09-17, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CLARA CELL 17 kD PROTEIN
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ccda_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ccdA (A:)
    ssdicpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivk
    ltekiltsplceqdlrv