PDB entry 1ccd

View 1ccd on RCSB PDB site
Description: refined structure of rat clara cell 17 kda protein at 3.0 angstroms resolution
Class: phospholipase a2 inhibitor
Keywords: phospholipase a2 inhibitor
Deposited on 1991-09-17, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CLARA CELL 17 kD PROTEIN
  Species: Rattus rattus [TaxId:10117]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17559 (0-76)
  Domains in SCOPe 2.08: d1ccda_
• Heterogens: SO4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ccdA (A:)
  ssdicpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivk
  ltekiltsplceqdlrv