PDB entry 1ccb

View 1ccb on RCSB PDB site
Description: the asp-his-fe triad of cytochrome c peroxidase controls the reduction potential, electronic structure, and coupling of the tryptophan free- radical to the heme
Deposited on 1993-01-04, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1ccb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ccb_ (-)
    mktttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtw
    dkhdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavq
    emqgpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahal
    gkthlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlpteys
    liqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ccb_ (-)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlpteysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl