PDB entry 1cc8

View 1cc8 on RCSB PDB site
Description: crystal structure of the atx1 metallochaperone protein
Deposited on 1999-03-04, released 1999-12-12
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-12, with a file datestamp of 1999-12-11.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.141
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1cc8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cc8A (A:)
  aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
  ktgkevrsgkql