PDB entry 1cc7

View 1cc7 on RCSB PDB site
Description: crystal structure of the atx1 metallochaperone protein
Deposited on 1999-03-04, released 1999-12-12
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-12, with a file datestamp of 1999-12-11.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.138
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1cc7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cc7A (A:)
  aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
  ktgkevrsgkql