PDB entry 1cc7

View 1cc7 on RCSB PDB site
Description: crystal structure of the atx1 metallochaperone protein
Class: metal transport
Keywords: copper transport, mercury coordination, metal transport
Deposited on 1999-03-04, released 1999-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.138
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (metallochaperone atx1)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cc7a_
  • Heterogens: BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cc7A (A:)
    maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
    kktgkevrsgkql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cc7A (A:)
    aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
    ktgkevrsgkql