PDB entry 1cc5

View 1cc5 on RCSB PDB site
Description:
Deposited on 1984-08-10, released 1984-10-29
The last revision prior to the SCOP 1.63 freeze date was dated 1985-10-29, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.29
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1cc5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cc5_ (-)
    gggarsgddvvakycnachgtgllnapkvgdsaawktradakggldgllaqslsglnamp
    pkgtcadcsddelkaaigkmsgl