PDB entry 1cc5

View 1cc5 on RCSB PDB site
Description: crystal structure of azotobacter cytochrome c5 at 2.5 angstroms resolution
Deposited on 1984-08-10, released 1984-10-29
The last revision prior to the SCOP 1.59 freeze date was dated 1985-10-29, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.29
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1cc5__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cc5_ (-)
  gggarsgddvvakycnachgtgllnapkvgdsaawktradakggldgllaqslsglnamp
  pkgtcadcsddelkaaigkmsgl