PDB entry 1cc3

View 1cc3 on RCSB PDB site
Description:
Deposited on 1999-03-03, released 1999-12-23
The last revision prior to the SCOP 1.59 freeze date was dated 1999-12-23, with a file datestamp of 1999-12-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.201
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1cc3a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1cc3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cc3A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcselcginh
    almkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cc3B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcselcginh
    almkgtltlk