PDB entry 1cbz

View 1cbz on RCSB PDB site
Description: crystal structure of the nadp+ dependent aldehyde dehydrogenase from vibrio harveyi. structural comparison with nad+ dependent enzymes.
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, nadp+ specificity, non classical nucleotide binding domain, thiohemiacetal intermediate, vibrio harveyi
Deposited on 1999-02-26, released 1999-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2000-05-24, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aldehyde dehydrogenase)
    Species: VIBRIO HARVEYI
    Gene: ALDH
    Database cross-references and differences (RAF-indexed):
    • GB U39638
      • conflict (440)
    Domains in SCOPe 2.08: d1cbza_
  • Chain 'B':
    Compound: protein (aldehyde dehydrogenase)
    Species: VIBRIO HARVEYI
    Gene: ALDH
    Database cross-references and differences (RAF-indexed):
    • GB U39638
      • conflict (440)
    Domains in SCOPe 2.08: d1cbzb_
  • Chain 'C':
    Compound: protein (aldehyde dehydrogenase)
    Species: VIBRIO HARVEYI
    Gene: ALDH
    Database cross-references and differences (RAF-indexed):
    • GB U39638
      • conflict (440)
    Domains in SCOPe 2.08: d1cbzc_
  • Chain 'D':
    Compound: protein (aldehyde dehydrogenase)
    Species: VIBRIO HARVEYI
    Gene: ALDH
    Database cross-references and differences (RAF-indexed):
    • GB U39638
      • conflict (440)
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cbzA (A:)
    mnpqtdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrt
    iaselearsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnp
    traplpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgt
    sqivaecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnl
    aherpepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalnt
    petqafietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasal
    fvtssenwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvs
    qliprleeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayq
    alpesllpdslkaenpleiaravdgkaahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cbzA (A:)
    qtdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrtias
    elearsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnptra
    plpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgtsqi
    vaecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnlahe
    rpepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalntpet
    qafietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasalfvt
    ssenwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvsqli
    prleeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayqalp
    esllpdslkaenpleiaravdgkaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cbzB (B:)
    mnpqtdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrt
    iaselearsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnp
    traplpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgt
    sqivaecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnl
    aherpepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalnt
    petqafietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasal
    fvtssenwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvs
    qliprleeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayq
    alpesllpdslkaenpleiaravdgkaahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cbzB (B:)
    nvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrtiasele
    arsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnptraplp
    kpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgtsqivae
    cieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnlaherpe
    pipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalntpetqaf
    ietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasalfvtsse
    nwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvsqliprl
    eeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayqalpesl
    lpdslkaenpleiaravdgkaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cbzC (C:)
    mnpqtdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrt
    iaselearsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnp
    traplpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgt
    sqivaecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnl
    aherpepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalnt
    petqafietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasal
    fvtssenwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvs
    qliprleeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayq
    alpesllpdslkaenpleiaravdgkaahs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cbzC (C:)
    nvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrtiasele
    arsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnptraplp
    kpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgtsqivae
    cieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnlaherpe
    pipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalntpetqaf
    ietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasalfvtsse
    nwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvsqliprl
    eeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayqalpesl
    lpdslkaenpleiaravdgkaa
    

  • Chain 'D':
    No sequence available.