PDB entry 1cby

View 1cby on RCSB PDB site
Description: delta-endotoxin
Class: toxin
Keywords: mosquitocidal, membrane pore, cytolytic, toxin
Deposited on 1995-09-05, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-endotoxin cytb
    Species: Bacillus thuringiensis serovar kyushuensis [TaxId:44161]
    Gene: CYTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cbyA (A:)
    mytknfsnsrmevkgnngcsapiirkpfkhivltvpssdldnfntvfyvqpqyinqalhl
    anafqgaidplnlnfnfekalqiangipnsaivktlnqsviqqtveisvmveqlkkiiqe
    vlglvinstsfwnsveatikgtftnldtqideawifwhslsahntsyyynilfsiqnedt
    gavmavlplafevsvdvekqkvlfftikdsaryevkmkaltlvqalhssnapivdifnvn
    nynlyhsnhkiiqnlnlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cbyA (A:)
    csapiirkpfkhivltvpssdldnfntvfyvqpqyinqalhlanafqgaidplnlnfnfe
    kalqiangipnsaivktlnqsviqqtveisvmveqlkkiiqevlglvinstsfwnsveat
    ikgtftnldtqideawifwhslsahntsyyynilfsiqnedtgavmavlplafevsvdve
    kqkvlfftikdsaryevkmkaltlvqalhssnapivdifnvnnynly