PDB entry 1cbx

View 1cbx on RCSB PDB site
Description: crystal structure of the complex between carboxypeptidase a and the biproduct analog inhibitor l-benzylsuccinate at 2.0 angstroms resolution
Class: hydrolase(c-terminal peptidase)
Keywords: hydrolase(c-terminal peptidase)
Deposited on 1991-10-31, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.08: d1cbxa_
  • Heterogens: ZN, BZS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbxA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn