PDB entry 1cbv

View 1cbv on RCSB PDB site
Description: an autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Class: immune system/DNA
Keywords: protein-DNA complex, single strand
Deposited on 1993-03-16, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.191
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: DNA (5'-d(*tp*tp*t)-3')
    Species: MUSCULUS
  • Chain 'H':
    Compound: protein (fab (bv04-01) autoantibody-heavy chain)
    Domains in SCOP 1.75: d1cbvh1, d1cbvh2
  • Chain 'L':
    Compound: protein (fab (bv04-01) autoantibody-light chain)
    Species: MUSCULUS
    Domains in SCOP 1.75: d1cbvl1, d1cbvl2

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbvH (H:)
    evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat
    yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs
    aakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
    glytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbvL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec