PDB entry 1cbu

View 1cbu on RCSB PDB site
Description: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase (cobu) from salmonella typhimurium
Deposited on 1998-03-12, released 1998-12-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cbua_
  • Chain 'B':
    Domains in SCOP 1.57: d1cbub_
  • Chain 'C':
    Domains in SCOP 1.57: d1cbuc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbuA (A:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbuB (B:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cbuC (C:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cbuC (C:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhdgrpahwrtaecwr
    hldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqiliaa
    cqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik