PDB entry 1cbu

View 1cbu on RCSB PDB site
Description: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase (cobu) from salmonella typhimurium
Class: cobalamin biosynthesis
Keywords: cobalamin biosynthesis, adenosylcobinamide, kinase, ATPase, guanylyltransferase, salmonella typhimurium, transferase, coenzyme b12
Deposited on 1998-03-12, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbua_
  • Chain 'B':
    Compound: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbub_
  • Chain 'C':
    Compound: adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbuc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbuA (A:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbuB (B:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cbuC (C:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhkdgrpahwrtaecw
    rhldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqilia
    acqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cbuC (C:)
    milvtggarsgksrhaealigdapqvlyiatsqilddemaariqhhdgrpahwrtaecwr
    hldtlitadlapddaillecittmvtnllfalggendpeqwdyaameraiddeiqiliaa
    cqrcpakvvlvtnevgmgivpenrlarhfrdiagrvnqrlaaaadevwlvvsgigvkik