PDB entry 1cbs

View 1cbs on RCSB PDB site
Description: crystal structure of cellular retinoic-acid-binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid
Class: retinoic-acid transport
Keywords: retinoic-acid transport
Deposited on 1994-09-28, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinoic acid binding protein type II
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN CRABP-II
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cbsa_
  • Heterogens: REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbsA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
    ltmtaddvvctrvyvre