PDB entry 1cbp

View 1cbp on RCSB PDB site
Description: phase determination by multiple-*wavelength x-ray diffraction. crystal structure of a basic (quote)*blue(quote) copper protein from cucumbers
Deposited on 1988-09-14, released 1988-10-09
The last revision was dated 1991-10-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: CU

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1cbp_ (-)
avyvvggsggwtfnteswpkgkrfragdillfnynptmhnvvvvnqggfstcntpagakv
ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal

    Sequence, based on observed residues (ATOM records):
    >1cbp_ (-)
wtfnteswpkgkrfragdillfnynptmhnvvvvnqggfstcntpagakvytsgrdqikl
pkgqsyficnfpghcqsgmkiavnal

  • Chain 'p':
    No sequence available.