PDB entry 1cbk

View 1cbk on RCSB PDB site
Description: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae
Class: transferase
Keywords: pyrophosphokinase, transferase
Deposited on 1999-02-26, released 2000-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.162
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase)
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cbka_
  • Chain 'B':
    Compound: protein (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase)
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cbkb_
  • Heterogens: SO4, ROI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbkA (A:)
    mitayialgsnlntpveqlhaalkaisqlsnthlvttssfykskplgpqdqpdyvnavak
    ietelsplklldelqrieneqgrvrlrrwgertldldillygneiiqnerltiphydmhn
    refvivplfeiasdlvlpnsqiitelvkqfadhkmiklnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbkB (B:)
    mitayialgsnlntpveqlhaalkaisqlsnthlvttssfykskplgpqdqpdyvnavak
    ietelsplklldelqrieneqgrvrlrrwgertldldillygneiiqnerltiphydmhn
    refvivplfeiasdlvlpnsqiitelvkqfadhkmiklnp