PDB entry 1cbi

View 1cbi on RCSB PDB site
Description: apo-cellular retinoic acid binding protein I
Class: retinoic-acid transport
Keywords: retinoic-acid transport
Deposited on 1995-07-12, released 1995-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular retinoic acid binding protein I
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE CRABPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbia_
  • Chain 'B':
    Compound: cellular retinoic acid binding protein I
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE CRABPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbiA (A:)
    pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
    teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
    tfgaddvvctriyvre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbiB (B:)
    pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
    teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
    tfgaddvvctriyvre