PDB entry 1cbg

View 1cbg on RCSB PDB site
Description: the crystal structure of a cyanogenic beta-glucosidase from white clover (trifolium repens l.), a family 1 glycosyl-hydrolase
Deposited on 1995-07-31, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1cbg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbg_ (-)
    fkplpisfddfsdlnrscfapgfvfgtassafqyegaafedgkgpsiwdtfthkypekik
    drtngdvaideyhrykedigimkdmnldayrfsiswprvlpkgklsggvnreginyynnl
    inevlangmqpyvtlfhwdvpqaledeyrgflgrnivddfrdyaelcfkefgdrvkhwit
    lnepwgvsmnayaygtfapgrcsdwlklnctggdsgrepylaahyqllahaaaarlyktk
    yqasqngiigitlvshwfepaskekadvdaakrgldfmlgwfmhpltkgrypesmrylvr
    krlpkfsteeskeltgsfdflglnyyssyyaakapripnarpaiqtdslinatfehngkp
    lgpmaasswlciypqgirklllyvknhynnpviyitengrnefndptlslqeslldtpri
    dyyyrhlyyvltaigdgvnvkgyfawslfdnmewdsgytvrfglvfvdfknnlkrhpkls
    ahwfksflkk