PDB entry 1cb9

View 1cb9 on RCSB PDB site
Description: nmr structure with tightly bound water molecules of cytotoxin II (cardiotoxin) from naja naja oxiana in aqueous solution (major form).
Class: toxin
Keywords: cytoxin (cardiotoxin), membrane perturbation, cis/trans isomerization, bound water, toxin
Deposited on 1999-03-01, released 1999-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytotoxin 2)
    Species: Naja oxiana [TaxId:8657]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cb9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb9A (A:)
    lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn