PDB entry 1cb8

View 1cb8 on RCSB PDB site
Description: chondroitinase ac lyase from flavobacterium heparinum
Class: lyase
Keywords: lyase, chondroitin degradation
Deposited on 1999-03-02, released 1999-05-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chondroitinase ac)
    Species: Pedobacter heparinus [TaxId:984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1cb8a1, d1cb8a2, d1cb8a3
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cb8A (A:)
    qqtgtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhl
    lqletiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemli
    lmrygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavke
    lfypvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalstekla
    ifskyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewada
    iartdstvaagykiepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgry
    lsdgatniqlrgpeyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdg
    vygasayaldydslqakkawfffdkeivclgaginsnapenitttlnqswlngpvistag
    ktgrgkittfkaqgqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdv
    fklwinhgarpenaqyayivlpginkpeeikkyngtapkvlantnqlqavyhqqldmvqa
    ifytagklsvagieietdkpcavlikhingkqviwaadplqkektavlsirdlktgktnr
    vkidfpqqefagatvelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cb8A (A:)
    gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
    etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
    ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
    pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
    kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
    tdstvaagykiepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsd
    gatniqlrgpeyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvyg
    asayaldydslqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktg
    rgkittfkaqgqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfkl
    winhgarpenaqyayivlpginkpeeikkyngtapkvlantnqlqavyhqqldmvqaify
    tagklsvagieietdkpcavlikhingkqviwaadplqkektavlsirdlktgktnrvki
    dfpqqefagatvelk