PDB entry 1cb7

View 1cb7 on RCSB PDB site
Description: glutamate mutase from clostridium cochlearium reconstituted with methyl-cobalamin
Class: isomerase
Keywords: glutamate mutase, coenzyme-b12, radical reaction, tim-barrel, rossman-fold, isomerase
Deposited on 1999-03-02, released 2000-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80078 (0-136)
      • conflict (44)
      • conflict (59)
    Domains in SCOPe 2.07: d1cb7a_
  • Chain 'B':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80077 (0-482)
      • conflict (129)
    Domains in SCOPe 2.07: d1cb7b_
  • Chain 'C':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80078 (0-136)
      • conflict (44)
      • conflict (59)
    Domains in SCOPe 2.07: d1cb7c_
  • Chain 'D':
    Compound: protein (glutamate mutase)
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80077 (0-482)
      • conflict (129)
    Domains in SCOPe 2.07: d1cb7d_
  • Heterogens: COB, TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb7A (A:)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqelfikaaietkadailv
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb7B (B:)
    melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
    tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
    llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
    yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
    aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
    eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
    mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
    vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
    rpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb7C (C:)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqelfikaaietkadailv
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb7D (D:)
    melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
    tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
    llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
    yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
    aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
    eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
    mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
    vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
    rpe