PDB entry 1cb6

View 1cb6 on RCSB PDB site
Description: structure of human apolactoferrin at 2.0 a resolution.
Class: iron transport
Keywords: iron transport, apolactoferrin, conformational change
Deposited on 1999-03-01, released 1999-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cb6a1, d1cb6a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb6A (A:)
    grrrsvqwcavsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtld
    ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
    rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
    cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
    kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
    kdsaigfsrvppridsglylgsgyftaiqnlrkseeevaarrarvvwcavgeqelrkcnq
    wsglsegsvtcssasttedcialvlkgeadamsldggyvytagkcglvpvlaenyksqqs
    sdpdpncvdrpvegylavavvrrsdtsltwnsvkgkkschtavdrtagwnipmgllfnqt
    gsckfdeyfsqscapgsdprsnlcalcigdeqgenkcvpnsneryygytgafrclaenag
    dvafvkdvtvlqntdgnnneawakdlkladfallcldgkrkpvtearschlamapnhavv
    srmdkverlkqvllhqqakfgrngsdcpdkfclfqsetknllfndnteclarlhgkttye
    kylgpqyvagitnlkkcstsplleaceflrk