PDB entry 1cb5

View 1cb5 on RCSB PDB site
Description: human bleomycin hydrolase.
Class: hydrolase
Keywords: hydrolase, aminopeptidase, cysteine protease, self-compartmentalizing, bleomycin
Deposited on 1999-03-01, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bleomycin hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13867 (0-452)
      • see remark 999 (278)
    Domains in SCOPe 2.07: d1cb5a_
  • Chain 'B':
    Compound: bleomycin hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13867 (0-452)
      • see remark 999 (278)
    Domains in SCOPe 2.07: d1cb5b_
  • Chain 'C':
    Compound: bleomycin hydrolase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13867 (0-452)
      • see remark 999 (278)
    Domains in SCOPe 2.07: d1cb5c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb5A (A:)
    sssglnsekvaaliqklnsdpqfvlaqnvgtthdlldiclkratvqraqhvfqhavpqeg
    kpitnqkssgrcwifsclnvmrlpfmkklnieefefsqsylffwdkvercyfflsafvdt
    aqrkepedgrlvqfllmnpandggqwdmlvnivekygvipkkcfpesytteatrrmndil
    nhkmrefcirlrnlvhsgatkgeisatqdvmmeeifrvvciclgnppetftweyrdkdkn
    yqkigpitplefyrehvkplfnmedkiclvndprpqhkhnklytveylsnmvggrktlyn
    nqpidflkkmvaasikdgeavwfgcdvgkhfnsklglsdmnlydhelvfgvslknmnkae
    rltfgeslmthamtftavsekddqdgaftkwrvenswgedhghkgylcmtdewfseyvye
    vvvdrkhvpeevlavleqepiilpawdpmgala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb5B (B:)
    sssglnsekvaaliqklnsdpqfvlaqnvgtthdlldiclkratvqraqhvfqhavpqeg
    kpitnqkssgrcwifsclnvmrlpfmkklnieefefsqsylffwdkvercyfflsafvdt
    aqrkepedgrlvqfllmnpandggqwdmlvnivekygvipkkcfpesytteatrrmndil
    nhkmrefcirlrnlvhsgatkgeisatqdvmmeeifrvvciclgnppetftweyrdkdkn
    yqkigpitplefyrehvkplfnmedkiclvndprpqhkhnklytveylsnmvggrktlyn
    nqpidflkkmvaasikdgeavwfgcdvgkhfnsklglsdmnlydhelvfgvslknmnkae
    rltfgeslmthamtftavsekddqdgaftkwrvenswgedhghkgylcmtdewfseyvye
    vvvdrkhvpeevlavleqepiilpawdpmgala
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb5C (C:)
    sssglnsekvaaliqklnsdpqfvlaqnvgtthdlldiclkratvqraqhvfqhavpqeg
    kpitnqkssgrcwifsclnvmrlpfmkklnieefefsqsylffwdkvercyfflsafvdt
    aqrkepedgrlvqfllmnpandggqwdmlvnivekygvipkkcfpesytteatrrmndil
    nhkmrefcirlrnlvhsgatkgeisatqdvmmeeifrvvciclgnppetftweyrdkdkn
    yqkigpitplefyrehvkplfnmedkiclvndprpqhkhnklytveylsnmvggrktlyn
    nqpidflkkmvaasikdgeavwfgcdvgkhfnsklglsdmnlydhelvfgvslknmnkae
    rltfgeslmthamtftavsekddqdgaftkwrvenswgedhghkgylcmtdewfseyvye
    vvvdrkhvpeevlavleqepiilpawdpmgala