PDB entry 1cb2

View 1cb2 on RCSB PDB site
Description: cellobiohydrolase II, catalytic domain, mutant y169f
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl), glycosidase, glycoprotein
Deposited on 1995-11-25, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellobiohydrolase II
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH2 (Y169F)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07987 (Start-364)
      • engineered (86)
    Domains in SCOPe 2.07: d1cb2a_
  • Chain 'B':
    Compound: cellobiohydrolase II
    Species: Hypocrea jecorina [TaxId:51453]
    Gene: CBH2 (Y169F)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07987 (Start-364)
      • engineered (86)
    Domains in SCOPe 2.07: d1cb2b_
  • Heterogens: NAG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cb2A (A:)
    sgtatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldkt
    plmeqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidti
    rqivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamyl
    daghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgna
    vyneklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsan
    tgdslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltna
    npsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cb2A (A:)
    tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
    meqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidtirq
    ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
    ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
    neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
    dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
    sfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cb2B (B:)
    sgtatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldkt
    plmeqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidti
    rqivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamyl
    daghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgna
    vyneklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsan
    tgdslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltna
    npsfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cb2B (B:)
    tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
    meqtladirtanknggnyagqfvvfdlpdrdcaalasngeysiadggvakyknyidtirq
    ivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
    ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
    neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
    dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
    sfl