PDB entry 1cb1

View 1cb1 on RCSB PDB site
Description: three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
Deposited on 1991-12-13, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1cb1__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cb1_ (-)
  saqkspaelksifekyaakegdpnqlskeelkqliqaefpsllkgprtlddlfqeldkng
  dgevsfeefqvlvkkisq