PDB entry 1cb1

View 1cb1 on RCSB PDB site
Description: three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1991-12-13, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calbindin d9k
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02632 (0-77)
  Domains in SCOPe 2.08: d1cb1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cb1A (A:)
  saqkspaelksifekyaakegdpnqlskeelkqliqaefpsllkgprtlddlfqeldkng
  dgevsfeefqvlvkkisq