PDB entry 1cb1

View 1cb1 on RCSB PDB site
Description: three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1991-12-13, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cb1A (A:)
    saqkspaelksifekyaakegdpnqlskeelkqliqaefpsllkgprtlddlfqeldkng
    dgevsfeefqvlvkkisq