PDB entry 1cb0

View 1cb0 on RCSB PDB site
Description: structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution
Deposited on 1999-02-26, released 1999-07-05
The last revision prior to the SCOP 1.65 freeze date was dated 1999-07-05, with a file datestamp of 1999-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1cb0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cb0A (A:)
    masgttttavkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllar
    hgrqhtimpskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmr
    pqsfydgshscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssr
    aesfmfrtwgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktl
    kenankakslllttipqigstewsetlhnlknmaqfsvllprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cb0A (A:)
    avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
    pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
    hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
    wgadvinmttvpevvlakeagicyasiamatdydcwavsvdrvlktlkenankakslllt
    tipqigstewsetlhnlknmaqfsvllp