PDB entry 1cb0

View 1cb0 on RCSB PDB site
Description: structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution
Class: transferase
Keywords: methylthioadenosine phosphorylase, purine nucleoside phosphorylase, purine salvage, adenine, transferase
Deposited on 1999-02-26, released 1999-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (5'-deoxy-5'-methylthioadenosine phosphorylase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cb0a_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cb0A (A:)
    masgttttavkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllar
    hgrqhtimpskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmr
    pqsfydgshscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssr
    aesfmfrtwgadvinmttvpevvlakeagicyasiamatdydcwkeheeavsvdrvlktl
    kenankakslllttipqigstewsetlhnlknmaqfsvllprh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cb0A (A:)
    avkigiiggtglddpeilegrtekyvdtpfgkpsdalilgkiknvdcvllarhgrqhtim
    pskvnyqaniwalkeegcthvivttacgslreeiqpgdiviidqfidrttmrpqsfydgs
    hscargvchipmaepfcpktrevlietakklglrchskgtmvtiegprfssraesfmfrt
    wgadvinmttvpevvlakeagicyasiamatdydcwavsvdrvlktlkenankakslllt
    tipqigstewsetlhnlknmaqfsvllp