PDB entry 1cav

View 1cav on RCSB PDB site
Description: the three-dimensional structure of canavalin from jack bean (canavalia ensiformis)
Deposited on 1993-05-27, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1cava_
  • Chain 'B':
    Domains in SCOP 1.71: d1cavb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cavA (A:)
    aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
    sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
    itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    k
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cavB (B:)
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqpr