PDB entry 1cau

View 1cau on RCSB PDB site
Description: determination of three crystal structures of canavalin by molecular replacement
Deposited on 1993-07-08, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1caua_
  • Chain 'B':
    Domains in SCOP 1.71: d1caub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cauA (A:)
    aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
    sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
    itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    k
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cauB (B:)
    tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
    ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
    dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
    gqpr