PDB entry 1cat

View 1cat on RCSB PDB site
Description: structure of beef liver catalase
Deposited on 1981-06-03, released 1981-06-03
The last revision was dated 1981-06-03, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1cat_ (-)
    adnrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdem
    ahfdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesg
    sadtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdm
    vwdfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqg
    iknlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltk
    vwphgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdt
    hrhrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsaleh
    rthfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavkn
    fsdvhpeygsriqalldkyneekpkn
    

    Sequence, based on observed residues (ATOM records):
    >1cat_ (-)
    pasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemahfdr
    eripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsadtv
    rdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvwdfw
    slrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgiknls
    vedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvwphg
    dyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthrhrl
    gpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrthfs
    gdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfsdvh
    peygsriqalldkyn
    

  • Chain 'p':
    No sequence available.