PDB entry 1caf

View 1caf on RCSB PDB site
Description: crystal structure of proteus mirabilis pr catalase with and without bound nadph
Deposited on 1995-02-24, released 1995-07-10
The last revision was dated 1995-07-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.159
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: MEO, HEM, NDP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1caf_ (-)
    mekkklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsga
    fgtftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteeg
    nwdmvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidms
    drglplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdress
    qrdlfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrn
    pdnyfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcp
    fhnyhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfs
    qpralyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle
    

    Sequence, based on observed residues (ATOM records):
    >1caf_ (-)
    kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
    ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
    mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
    lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
    lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
    yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
    yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
    alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvl
    

  • Chain 'p':
    No sequence available.