PDB entry 1cac

View 1cac on RCSB PDB site
Description: crystal structure of human erythrocyte carbonic anhydrase c, $vi.the three-dimensional structure at high resolution in relation to other mammalian carbonic anhydrases
Deposited on 1976-05-22, released 1976-06-09
The last revision was dated 1990-01-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1cac_ (-)
    shhwgygkhdgpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    dghafnvefddsedkavlkggpldgtyrliqfhfhwgsldgegsqhtvdkkkyaaelhlv
    hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfdgegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records):
    >1cac_ (-)
    hwgygkhdgpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilndg
    hafnvefddsedkavlkggpldgtyrliqfhfhwgsldgegsqhtvdkkkyaaelhlvhw
    ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
    lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfdgegepeelmvdn
    wrpaqplknrqikasf
    

  • Chain 'p':
    No sequence available.