PDB entry 1ca9

View 1ca9 on RCSB PDB site
Description: structure of tnf receptor associated factor 2 in complex with a peptide from tnf-r2
Class: tnf signaling
Keywords: tnf signaling, traf, adapter protein, cell survival
Deposited on 1999-02-25, released 1999-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tnf receptor associated factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ca9a1, d1ca9a2
  • Chain 'B':
    Compound: protein (tnf receptor associated factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ca9b1, d1ca9b2
  • Chain 'C':
    Compound: protein (tnf receptor associated factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ca9c1, d1ca9c2
  • Chain 'D':
    Compound: protein (tnf receptor associated factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ca9d1, d1ca9d2
  • Chain 'E':
    Compound: protein (tnf receptor associated factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ca9e1, d1ca9e2
  • Chain 'F':
    Compound: protein (tnf receptor associated factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ca9f1, d1ca9f2
  • Chain 'G':
    Compound: protein (tnf-r2)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: protein (tnf-r2)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ca9A (A:)
    dqdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeav
    agripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqk
    vtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrdda
    ifikaivdltgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca9A (A:)
    qdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeava
    gripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkv
    tlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddai
    fikaivdltgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ca9B (B:)
    dqdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeav
    agripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqk
    vtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrdda
    ifikaivdltgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca9B (B:)
    qdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeava
    gripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkv
    tlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddai
    fikaivdltgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ca9C (C:)
    dqdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeav
    agripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqk
    vtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrdda
    ifikaivdltgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca9C (C:)
    qdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeava
    gripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkv
    tlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddai
    fikaivdltgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ca9D (D:)
    dqdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeav
    agripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqk
    vtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrdda
    ifikaivdltgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca9D (D:)
    alsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeavagripa
    ifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmll
    dqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikai
    vdltgl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ca9E (E:)
    dqdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeav
    agripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqk
    vtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrdda
    ifikaivdltgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca9E (E:)
    alsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeavagripa
    ifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmll
    dqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikai
    vdltgl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ca9F (F:)
    dqdkiealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeav
    agripaifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqk
    vtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrdda
    ifikaivdltgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca9F (F:)
    alsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfarkrqeavagripa
    ifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmll
    dqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikai
    vdltgl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.