PDB entry 1ca6

View 1ca6 on RCSB PDB site
Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to DNA
Class: structural protein/DNA
Keywords: hyperthermophile, chromosomal protein, sso7d, sac7d, DNA binding
Deposited on 1999-02-23, released 2000-02-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chromosomal protein sac7d
  Species: Sulfolobus acidocaldarius
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (1-65)
  Domains in SCOP 1.73: d1ca6a_
• Chain 'B':
  Compound: 5'-d(*gp*tp*gp*ap*tp*cp*gp*c)-3'
  
• Chain 'C':
  Compound: 5'-d(*gp*tp*gp*ap*tp*cp*gp*c)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ca6A (A:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.