PDB entry 1ca6

View 1ca6 on RCSB PDB site
Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna
Deposited on 1999-02-23, released 2000-02-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1ca6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ca6A (A:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekk