PDB entry 1ca5

View 1ca5 on RCSB PDB site
Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to DNA
Class: structural protein/DNA
Keywords: hyperthermophile, chromosomal protein, sso7d, sac7d, DNA binding
Deposited on 1999-02-23, released 2000-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 2004-03-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromosomal protein sac7d
    Species: Sulfolobus acidocaldarius
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ca5a_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*gp*ap*tp*cp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*tp*gp*ap*tp*cp*ap*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ca5A (A:)
    mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
    aerekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ca5A (A:)
    vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara
    erekk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.