PDB entry 1ca5

View 1ca5 on RCSB PDB site
Description: intercalation site of hyperthermophile chromosomal protein sso7d/sac7d bound to dna
Deposited on 1999-02-23, released 2000-02-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-26, with a file datestamp of 2000-10-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ca5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ca5A (A:)
    vkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlara
    erekk