PDB entry 1ca1

View 1ca1 on RCSB PDB site
Description: alpha-toxin from clostridium perfringens
Deposited on 1998-04-22, released 1999-05-04
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-04, with a file datestamp of 1999-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ca1_ (-)
    wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
    aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
    lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintvgcktnedfyadil
    knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
    hdvsegndpsvgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfm
    tgskdtytfklkdenlkiddiqnmwirkrkytafpdaykpenikviangkvvvdkdinew
    isgnstynik