PDB entry 1ca1

View 1ca1 on RCSB PDB site
Description: alpha-toxin from clostridium perfringens
Class: hydrolase
Keywords: zinc phospholipase c, gangrene determinant, c2 domain, ca and membrane binding, hydrolase
Deposited on 1998-04-22, released 1999-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-toxin
    Species: Clostridium perfringens [TaxId:1502]
    Gene: CPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15310 (0-369)
      • strain difference (166)
      • strain difference (173)
      • strain difference (176)
      • strain difference (334)
      • strain difference (344)
    Domains in SCOPe 2.07: d1ca1a1, d1ca1a2
  • Heterogens: ZN, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ca1A (A:)
    wdgkidgtgthamivtqgvsilendlsknepesvrknleilkenmhelqlgstypdydkn
    aydlyqdhfwdpdtdnnfskdnswylaysipdtgesqirkfsalaryewqrgnykqatfy
    lgeamhyfgdidtpyhpanvtavdsaghvkfetfaeerkeqykintvgcktnedfyadil
    knkdfnawskeyargfaktgksiyyshasmshswddwdyaakvtlansqkgtagyiyrfl
    hdvsegndpsvgknvkelvayistsgekdagtddymyfgiktkdgktqewemdnpgndfm
    tgskdtytfklkdenlkiddiqnmwirkrkytafpdaykpenikviangkvvvdkdinew
    isgnstynik