PDB entry 1c9x

View 1c9x on RCSB PDB site
Description: h119a variant of ribonuclease a
Class: hydrolase
Keywords: antiparallel beta sheet, cis-proline, hydrolase
Deposited on 1999-08-03, released 2001-06-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (118)
  Domains in SCOPe 2.05: d1c9xa_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c9xA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvaf
  dasv