PDB entry 1c9u

View 1c9u on RCSB PDB site
Description: crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq
Deposited on 1999-08-03, released 2000-02-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1c9ua_
  • Chain 'B':
    Domains in SCOP 1.57: d1c9ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c9uA (A:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9uA (A:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkpnqtiirrytynkstd
    tlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtptqqe
    lngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkllqseq
    gpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaagvpv
    tkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkkaitg
    wentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvltdta
    gnvqkddgsvtntlenpgslikft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9uB (B:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikftyk