PDB entry 1c9t

View 1c9t on RCSB PDB site
Description: complex of bdellastasin with bovine trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: complex (hydrolase/inhibitor), hydrolase, inhibitor, antistasin, plasmin, hydrolase/hydrolase inhibitor complex
Deposited on 1999-08-03, released 2000-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.208
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9ta_
  • Chain 'B':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9tb_
  • Chain 'C':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9tc_
  • Chain 'D':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9td_
  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9te_
  • Chain 'F':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c9tf_
  • Chain 'G':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • TREMBL P82107 (Start-58)
    Domains in SCOPe 2.06: d1c9tg_
  • Chain 'H':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • TREMBL P82107 (Start-58)
    Domains in SCOPe 2.06: d1c9th_
  • Chain 'I':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • TREMBL P82107 (Start-58)
    Domains in SCOPe 2.06: d1c9ti_
  • Chain 'J':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • TREMBL P82107 (Start-58)
    Domains in SCOPe 2.06: d1c9tj_
  • Chain 'K':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • TREMBL P82107 (Start-58)
    Domains in SCOPe 2.06: d1c9tk_
  • Chain 'L':
    Compound: bdellastasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • TREMBL P82107 (Start-58)
    Domains in SCOPe 2.06: d1c9tl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9tA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9tB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9tC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9tD (D:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9tE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9tF (F:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1c9tG (G:)
    fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9tG (G:)
    ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c9tH (H:)
    fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9tH (H:)
    ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1c9tI (I:)
    fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9tI (I:)
    ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1c9tJ (J:)
    fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9tJ (J:)
    ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1c9tK (K:)
    fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9tK (K:)
    ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1c9tL (L:)
    fdvnshttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c9tL (L:)
    ttpcgpvtcsgaqmcevdkcvcsdlhckvkcehgfkkddngceyacicadapq