SCOPe 2.03: Structural Classification of Proteins

PDB entry 1c9s

View 1c9s on RCSB PDB site
Description: crystal structure of a complex of trp RNA-binding attenuation protein with a 53-base single stranded RNA containing eleven gag triplets separated by au dinucleotides
Class: RNA binding protein/RNA
Keywords: trap, protein-RNA complex, transcription, single stranded RNA, RNA binding protein/RNA complex
Deposited on 1999-08-03, released 1999-09-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sa_
Chain 'B':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sb_
Chain 'C':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sc_
Chain 'D':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sd_
Chain 'E':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9se_
Chain 'F':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sf_
Chain 'G':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sg_
Chain 'H':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sh_
Chain 'I':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9si_
Chain 'J':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sj_
Chain 'K':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sk_
Chain 'L':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sl_
Chain 'M':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sm_
Chain 'N':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sn_
Chain 'O':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9so_
Chain 'P':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sp_
Chain 'Q':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sq_
Chain 'R':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sr_
Chain 'S':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9ss_
Chain 'T':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9st_
Chain 'U':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9su_
Chain 'V':
Compound: trp RNA-binding attenuation protein
Species: Geobacillus stearothermophilus [TaxId:1422]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X6J6
Domains in SCOPe 2.03: d1c9sv_
Chain 'W':
Compound: single stranded RNA (55-mer)
Species: synthetic, synthetic
Heterogens: TRP, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1c9sA (A:)
mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
iqtrhgviesegkk